GenomeNet

>bsu:BSU13200 K17763 rsbT co-antagonist protein RsbR | (RefSeq) rsbRB; RsbT co-antagonist protein RsbRB (A)
MKLNEKLYAFFSEHVEQMAEEWIETMEESDPNSLYALHNATVTEELKEQDREFYRHLNYM
YVLPEKQFLEEFQEWVIELTNDQKHLDTPVQYVIREFMRNRRLYTKYFEKFAEENESAFE
PGEKQKWADLIVKVFDFTIYTFVDHAEMNAKQQLNAQREMILELSSPVITLSKSTALLPL
VGDIDTERAKFILENTLQACAKRRVEHLLIDLSGVVVVDTMVAHQIFKLIEALNLIGVRS
TLSGIRPEIAQTAVQLGIDFSNITIKTNLAQALNYHQ

BLAST