GenomeNet

>bsu:BSU13290 no KO assigned | (RefSeq) ykzD; hypothetical protein (A)
MEKKEEQYINQAEYVPHPTKEGEYALFLHETYHLLSEDDETQTTE

BLAST