GenomeNet

>bsu:BSU13470 K06421 small acid-soluble spore protein D (minor alpha/beta-type SASP) | (RefSeq) sspD; small acid-soluble spore protein D (A)
MASRNKLVVPGVEQALDQFKLEVAQEFGVNLGSDTVARANGSVGGEMTKRLVQQAQSQLN
GTTK

BLAST