GenomeNet

>bsu:BSU13480 no KO assigned | (RefSeq) ykrK; hypothetical protein (A)
MNIFKLSRTDMVRLLYSLKGQGEHSPLDILVQSANMSAEKAANHLEIPEFLTRYERKKQK
KEYGLSTNEIVELGNLCELTSLKSTAIQNWVKRDIKDLIGHPELGKKYSIEQAVILLIVR
DLKSIYDFEHIRAILKVAFNTISDRSDDVISPIAYYESCAYVLDAIHHQDTPSMKESNLQ
EIAEQETERLRHRFEELNDSQWLKIRQIIAITVLSILTFHIQATAHKMTADIL

BLAST