GenomeNet

>bsu:BSU13500 no KO assigned | (RefSeq) ktrD; ktr system potassium uptake protein D (A)
MRLKFGKLIQALSPAQLIALYYFLAVTVAVILLSLPAAHKPGADWTFIDALFTAVSSVSV
TGLTVVDTADTFSTIGIFILAFVLQFGGIGIMTLGTFIWLIMGKRIGLKERKLIMVDQNQ
SQFSGIVNLMKQVLFLILWIEFFGGLILGTYFLTYYDSYQEAYLHGFFASISATTNGGFD
ITGNSMIPFRHDYFVQFITMLLIIFGAIGFPVLVEVKDFLFSKHRRYPFTLFTKITTITF
GSLVLFGAIGIFALEANHAFAGKSWHDILFLSLFQSTATRSGGLATIDISQLSDSTLFFI
CALMFIGASPSSVGGGIRTTTFALNLLALFHFARGNKAVKVFKRELHPADLMKSLVVTMM
AILLVFGATLILTITEKHSLLELLFEVCSAFGTTGLSLGITADLSSVGKCVIMIVMFIGR
IGILTFLYLIGRKEIEANYHYPKERVIIG

BLAST