GenomeNet

>bsu:BSU13540 K00567 methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63] | (RefSeq) ogt; methylated-dna--protein-cysteine methyltransferase (A)
MNYYTTAETPLGELIIAEEEDRITRLFLSQEDWVDWKETVQNTEHKETPNLAEAKQQLQE
YFAGERKTFSLPLSQKGTPFQQKVWQALERIPYGESRSYADIAAAVGSPKAVRAVGQANK
RNDLPIFVPCHRVIGKNSALTGYAGSKTEIKAFLLNIERISYKEK

BLAST