GenomeNet

>bsu:BSU13830 no KO assigned | (RefSeq) ykvU; sporulation protein YkvU (A)
MNRFVKGIILLSIAAFFAECLEFVVNMILARELGEHGMGLYMSILPTIFLIIVIASLELP
ISISKFIAESNPKLHESMLRHAFRMTAIFTAFSTAAASIALPFIPVFDTYHPFIKGIVIG
LIPVVAFTSIARGYFMGVQKMGKIAIANVLKKIIQLLCLFLFFQWYSFELDMAVLISLFV
LVVSDVVVLVYLYSQFIMARRALSGQQHIHLRGKDVRKRLLAVSIPTTGLRIFHAVVNAI
EPFLVKGALLAAGVAGTAAIDQYGMLAGVAVTIGSFPAFIAHSLMVVMIPSISEAYALSQ
YDIVLKRLKQSIFITLGYGIPAVWVMFQFAGPLTHLFFHSPEAQYYLQLLWPYFLFHLFV
MPLQACLIGMGFVKEAFYHNVWSHIVALSMMYVLGSMENLQMLGIILGMNTGMILLTSLH
YATICKALKVSVFLTGGTRTPRIEG

BLAST