GenomeNet

>bsu:BSU13900 K11189 phosphocarrier protein | (RefSeq) ptsH; phosphocarrier protein HPr (A)
MAQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAE
ITISASGADENDALNALEETMKSEGLGE

BLAST