GenomeNet

>bsu:BSU14010 K03415 two-component system, chemotaxis family, chemotaxis protein CheV | (RefSeq) cheV; chemotaxis protein CheV (A)
MSLQQYEILLDSGTNELEIVKFGVGENAFGINVMKVREIIQPVEVTSVPHSHQHVEGMIK
LRGEILPVISLFSFFGVEPEGSKDEKYIVTEFNKRKIVFHVGSVSQIHRVSWEAIEKPTS
LNQGMERHLTGIIKLEDLMIFLPDYEKIIYDIESDSGVDTYNMHTEGFDERRTDKKLIIV
EDSPLLMRLLQDELKEAGYNNIASFENGKEAYEYIMNLAENETDLSKQIDMIITDIEMPK
MDGHRLTKLLKENPKSSDVPVMIFSSLITDDLRHRGEVVGADEQISKPEISDLIKKVDTY
VIE

BLAST