GenomeNet

>bsu:BSU14100 no KO assigned | (RefSeq) ykuJ; hypothetical protein (A)
MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPN
TYPFDNIDMVSIEIFELLQ

BLAST