GenomeNet

>bsu:BSU14210 K22044 moderate conductance mechanosensitive channel | (RefSeq) ykuT; MscS family protein YkuT (A)
MDFIKQYDWAGLITNAGVLLIKLAIMILLYFIVRSLGMKIIKHLFAKFEEQNSLSIGRAH
TLRSLTLNIFAYTLIFIFFVMVLDLFHYDPSALLAGAGIVGLAVGFGAQGLVSDIVTGFF
ILLEKQLDVGDYITVSTFDGIVEQVGLRTTQIRSFDGTLHYIPNRNITNVSNHSRGTMQA
LVDIKVPAERNIDEMIHILQQVCDETAAALPQIKEGPNVIGIQELGTSEIVIRVIAKTEN
MEQWRVERVLRKEIKNAFDRAFPKETE

BLAST