GenomeNet

>bsu:BSU14250 K06437 sigma-E controlled sporulation protein | (RefSeq) yknT; sporulation protein cse15 (A)
MKRSGPFFHDVSQENLYLKSELSRCHKLISELEASYFHQKNNKLLKENTDMKEKLQQLSA
ELTHMSTKEKHASHTSQTLHQIRAELLDKIVVLQELLSAETYKRRAEIEEKHKLHIAKVK
IEEENKNLHKRISELQASIEQEQNALLQAKQQAELIKAENGRLKEQMVEKEYQLKHIKIE
VDHMKDRIIETKERLLDIEKTKEKLFHETIISYKRQLDESDAWIASHFADIDGGTKQKEK
TEEEAPAAYAQPNHVETILEDVTKQIHVLQKQLAHAQSSDQAKSHTIEELKNRAAEEKPY
QKWVYKLNLEKENKPSQKKPQ

BLAST