GenomeNet

>bsu:BSU14510 K03499 trk system potassium uptake protein | (RefSeq) ktrC; ktr system potassium uptake protein C (A)
MKKEFAVIGLGRFGGSICKALSEEGVEVMAMDIDEDKVNEYAKIASHAVIGDSTDESVLK
NLGLRNFDHVIVAIGENIQASILTTLILKELGVHTITVKAQNDYHEKVLSKIGADHIVHP
ERDMAKRIAHNIVSNNVLDYLELSEEHSLVEIVANSRLAGNTLLDLDIRAKYGINIVAIK
RGKEVIVSPLATEVIHQEDILIVIGSVTDISRFEKRVLHTK

BLAST