GenomeNet

>bsu:BSU14640 no KO assigned | (RefSeq) yktA; hypothetical protein (A)
MEYQYPMNEDWTTEEAVDVIAFFQQVELAYEKGADREELLKAYRRFKEIVPGKAEEKKLC
GEFEEQSTYSPYRTVKQARESDHAKIKM

BLAST