GenomeNet

>bsu:BSU14810 K07175 PhoH-like ATPase | (RefSeq) ylaK; hypothetical protein (A)
MSKIYVLDTNVLLQDPNAIFSFEENEVVIPAVVLEEVDSKKRYMDEVGRNARHVSKLIDA
LRQKGRLHEHVPLDTGGTLRIELNHRSFHQLQEIFIEKTNDNRILAVAKNLSLEEETKEN
GRPVILVSKDVLVRVKADAIGLLAEDFLNDRVVDNDEMYSGYKDLYISQQLFSSFYGKNQ
ISVNDVKQHAFYPNQFALMKDELGGSSSAVGIADKTGTVLKRLVFDDEHIWGIRPKNVQQ
TMALELLLREDIPLVTLIGKAGTGKTLLALAAGLLQTEDLGIYKKLVVARPIVPVGKDIG
YLPGEKEEKLKPWMQPIFDNLEFLFNAKKPGELDAILAGIGSIQVEALTYIRGRSIPDQF
IIIDEAQNLTRHEVKTLLTRVGEGSKIVLMGDPEQIDHPYLDSLNNGLAYVVERFKGQPI
SGSVKLLKGERSGLAQLAADLL

BLAST