GenomeNet

>bsu:BSU14850 K03588 cell division protein FtsW | (RefSeq) ftsW; lipid II flippase FtsW (A)
MLKKMLKSYDYSLIFAIVLLCGFGLVMVYSSSMITAVSRYGVSSNFFFMRQLFALIAGGA
LFILMALFPYKALAHQKFQKGILLVSVLALISLFVFGHVAGNAQSWFKIGGMSIQPGEFV
KLVVILYLAAVYAKKQSYIDHLLTGVAPPVVMTLIICGLIAMQPDFGTAMIIGLIATCMI
LCSGFSGKTLVRLVILGGIVFILVSPIIYLNQDKILTEGRLARFESLEDPFKYANSSGLQ
VINSYYAISSGGIFGLGLGESIQKYGYLPESHTDFIMAVIAEELGIFGVLFVIFLLGFVV
IKGFYIARKCEDPFGSLLAIGISSMIAIQSFINLGGVSGLIPITGVTLPFISYGGSSLVL
LLGSMGILANISMFVKYSENKKKKEPLAPKGMKKKQLKKTVYL

BLAST