GenomeNet

>bsu:BSU15060 no KO assigned | (RefSeq) ylbM; hypothetical protein (A)
MKAVGLVVEYNPFHNGHLYHAQTAKLQTGCDTAVAVMSGHFLQRGEPAVVSKWARTKMAL
QSGVDLVIELPYLYAVQKADIFARGSVSILNELECEALFFGSENGDIKPFLETAQLIDEH
KHILNDRIKEELKKGASYPAAAAIAFSSILHTESALDLSKPNNILGYQYVTSILTGGYPM
KPYTTARISSDYHDADLPEGENHIASATSIRKAMIGQNLEACLRFLPAASARELAAYRKS
FGLWHTPESYFSYLKYSLSTVTARELQQVYEVEEGLEHRIIRSIRKSSSYQEFMELLKTK
RYTWTRLQRMNTHILTRTKKQDMQKLLDNDKAPYIRLLGMTKKGQAYLSEKKKALSVPLV
SKLSSFSHPALDLDVKASRIYSLPIEEPLRTEFDLQEYGHAPIRYDEDEQHFLNV

BLAST