GenomeNet

>bsu:BSU15070 K07040 uncharacterized protein | (RefSeq) ylbN; hypothetical protein (A)
MKWTIYQLHQMPKQSFEFDETVELNELTKLNSDIRRISPVRVKGRADIKSKQVSFDFTIS
GEMLLPCSRTLVDVPYPFEISTKELFIFHHTDDIEDDDVHIVEDDTIDITPIVKEEILLE
IPMQIFCESEQEKGAAPQEGKDWQVISEEDKKNQVDPRLAALEKLLKQDDES

BLAST