GenomeNet

>bsu:BSU15260 no KO assigned | (RefSeq) ylxX; hypothetical protein (A)
MKIKRSFISISVLMVIFGLMISVQFNSLKHPKVRDTRDMWDIREELTSEQKKQEKLLAEI
NKYDKLLNSYSQTKEMTKETALNNTLQSLKKTAGMTDITGSGIVITISPLFSESLTGEPI
ENPPPDLLKKLINELNSYGAEHISINERRVVNHTVIRDINGTTKIDGYALDDYPLTVKVL
AKDPDMLHSRVKGSGLEDLFASENLALKAGKSESKLTLKAYDRPLDVQQLKLLKD

BLAST