GenomeNet

>bsu:BSU15370 K05810 polyphenol oxidase [EC:1.10.3.-] | (RefSeq) ylmD; laccase domain protein YlmD (A)
MNTYHPFSLTTPSTLMIQDWAQTNQNNKEVIAGFTTKNGGVSQKPFESLNTGLHVHDKDA
DVVKNREYIADMFNTDLQSWVFADQTHDNRVQKVTQRDRGKGAREYHTALKATDGIYTNE
KNVFLALCFADCVPLFFYDPVKSLVGVAHAGWKGTVKQIGREMVKQWTEKEGSNPSDIYA
VIGPSISGACYTVDDRVMDAVRALPVSADLAANQTAKAQYQLDLKELNRLILMDSGLASE
QISVSGLCTESEPSLFYSHRRDQGKTGRMMSFIGMKEA

BLAST