GenomeNet

>bsu:BSU15710 K04066 primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-] | (RefSeq) priA; primosomal protein N' (A)
MNFAEVIVDVSTKNIDRPFDYKIPDHLKGMIKTGMRVIVPFGPRKIQGFVTAVKEASDLS
GKSVKEVEDLLDLTPVLTEELMILSSWLSDKTLSFKITALQAMLPAALKAKYEKELKIAH
GADLPPQVERLFSETKTLLYSDIPDHETLKLIQRHVQKGDIDVTYKVAQKTNKKMVRHIQ
ANASKEELAKQAEGLSRQAAKQQAILHFLISEPEGVKIPAAELCKKTDTSSATIKTLIQK
GLLKESYEEVYRDPYQDKMFKKTEPLPLTDEQRAAFEPIRETLDSDEHKVFLLHGVTGSG
KTEIYLQSIEKVLAKGKEAIVLVPEISLTPQMVNRFKGRFGSQVAVMHSGLSTGEKYDEW
RKIHRKEVRLVVGARSAIFAPFENLGMIIIDEEHESSYKQEEMPRYHAKEVAIKRAEHHS
CPVVLGSATPTLESYARAQKGVYELLSLKHRVNHRVMPEVSLVDMREELRNGNRSMFSVE
LMEKLEETIAKGEQAVLFLNKRGYSSFVMCRDCGYVPQCPHCDISMTYHRYGQRLKCHYC
GHEEPVPHTCPECASEHIRFFGTGTQRVEEELTKVLPSARVIRMDVDTTSRKGAHEKLLS
AFGEGKADILLGTQMIAKGLDFPNVTLVGVLSADTTLHIPDFRSAEKTFQLLTQVSGRAG
RHEKPGHVIIQTYTPSHYSIQLTKTHDYETFYQHEMAHRREQSYPPYYYLALVTVSHEEV
AKAAVTAEKIAHFLKANCGADTKILGPSASPIARIKDRYRYQCVIKYKQETQLSALLKKI
LEHYKREIEQKHVMISIDMNPYMMM

BLAST