GenomeNet

>bsu:BSU16000 K06960 uncharacterized protein | (RefSeq) ylqC; hypothetical protein (A)
MTDQHLEDLIVHIVTPLVDHPDDIRVIREETDQKIALRLSVHKSDTGKVIGKQGRTAKAI
RTAVFAAGVQSSKKVQFEIFD

BLAST