GenomeNet

>bsu:BSU16180 K02387 flagellar basal-body rod protein FlgB | (RefSeq) flgB; flagellar basal body rod protein FlgB (A)
MSLFSGTIQNLENALSRADIKQKVITNNIANIDTPNYKAKKVSFQNLLDQESSRLEAIKT
DYRHVDFSDTDSNYSIVASGDTSYQQNGNNVDVDKEMTELAQNQINYQALVERMNGKFNS
LKTVLTGGK

BLAST