GenomeNet

>bsu:BSU16210 K02409 flagellar M-ring protein FliF | (RefSeq) fliF; flagellar M-ring protein (A)
MNRTLMQMKNKTSEFWKNRSKLQKILMVSALAAIIIIGIIISVFASNSKMAPLYKDLSAE
EAGQIKEELDAKKVPNELSNGGTVISVPEDQVDSLKVQMAAEGLPKTGSIDYSFFGQNAG
FGLTDNEFDMVKVKATQTELSNLINEMDGIKNSKVMINLPKDAVFVGEEQSAASASIVLQ
IQPGYTLDQSQINGLYHLVSKSVPNLKEDNIVIMDQNSTYYDKSDSDAGSYADSYSSQQG
IKSQVEKDIQKHVQSLLGTMMGQDKVVVSVTADIDFTKENRTEDIVEPVDKENMEGIAVS
AEKVSETYQGDGAANGGTAGTGEEDVTNYKADGENTESGNYEKNSNKINYEVNRIHKEIA
ESPYKVRDLGIQVMVEPPDAKNTASLSTERQDDIQKILSTVVRTSLDKDETQNQNLSDAD
INNKIVVSVQPFDGKVNLDTNTEESSGIPLWAYIVGGVLIAAIIVLIIMLIRKKRAQEDE
FEEYEYEVPQEPINLPDINEEENETAESVRRKQLEKMAKDKPEDFAKLLRSWLAED

BLAST