GenomeNet

>bsu:BSU16270 K02414 flagellar hook-length control protein FliK | (RefSeq) fliK; flagellar hook-length control protein (A)
MKLLELAGPLLQTTTGSAAKNMKSSQGVFQNWLMSEAGLKELSEQGKGTPNSEDQLLADA
LKKIGEWLNASPEDQDKQNADLLQTLSKLTGKQLDANALQMLQNLLQAVESKMSGGTDQL
LTETEKIFSEAKTALSANDSASDINGALKSDKEQSNQENEVSEPAKELIYIQMFISQLVE
GNKLTDLGNGNEAHAIYQNGDQFLSALEKKGVSQQLIQDLKQQIFTKAESSSKLYSMTAS
ELKSFQSLMDQMSMLPQKGTKEWSLAESQLKAFLLSKSSESSQDFGKSVLTPLSQSSSSK
NASDVSGSIQPVDSKSGLQMLFSGYRGIGGVQTLDLQQMSSDIPNAETKTVADQVINAWK
QMKYTPFGRSTGSFTIRLNPEHLGFVTIKLTNENGMFQSKIIASSQSAKELLEQHLPQLK
QSLPNMAVQIDRFTLPVQSGDQPIYGQLADEQKQQQEGQRQQRQKKQSNDFGDLLDEVSM
VEMEEEE

BLAST