GenomeNet

>bsu:BSU16300 K02415 flagellar protein FliL | (RefSeq) fliL; flagellar protein FliL (A)
MKKKLMIILLIILIVIGALGAAAYFVLGGKSEKSEAKKSIDEIVASSVDVEEITTNLKSD
NIIRLAIKLETDSDKSKEELEKRDFQVKDAVISLLADTNADQIEGDKGKETFKKELKDKI
NSYLQEGKVEKVYITSFNLQ

BLAST