GenomeNet

>bsu:BSU16610 K07742 uncharacterized protein | (RefSeq) ylxR; hypothetical protein (A)
MNKHKKIPLRKCVVTGEMKPKKELIRVVRSKEGEISVDPTGKKNGRGAYLTLDKECILAA
KKKNTLQNQFQSQIDDQIFDELLELAEKVKK

BLAST