GenomeNet

>bsu:BSU16680 K02956 small subunit ribosomal protein S15 | (RefSeq) rpsO; 30S ribosomal protein S15 (A)
MAITQERKNQLINEFKTHESDTGSPEVQIAILTDSINNLNEHLRTHKKDHHSRRGLLKMV
GKRRNLLTYLRNKDVTRYRELINKLGLRR

BLAST