GenomeNet

>bsu:BSU16700 no KO assigned | (RefSeq) ylxY; hypothetical protein (A)
MYKKFVPFAVFLFLFFVSFEMMENPHALDYIGAMKKDTVTVTASKDPLYEELLQKAPEYE
VKPQNARIDKVWKSIPGYNGLKVNIEQSYKKMKQHGKFREKDLVYSQVKPSVHLESLQPE
PIYKGNPDKPMVAFLINVAWGNEYLEKMLPILQKHQVKATFFLEGNWVRNNVQLAKKIAK
DGHEIGNHSYNHPDMSKLTTGRISEQLDKTNEQIEQTIGVKPKWFAPPSGSFRKAVIDIA
AEKQMGTVMWTVDTIDWQKPAPSVLQTRVLSKIHNGAMILMHPTDPTAESLEALITQIKD
KGYALGTVTELMDETRLLK

BLAST