GenomeNet

>bsu:BSU16790 no KO assigned | (RefSeq) tepA; translocation-enhancing protein TepA (A)
MDHRMENTEEERPEKNDAKDSIMNKIQQLGETTLPQLPQDTNIHCLTIIGQIEGHVQLPP
QNKTTKYEHVIPQIVAIEQNPKIEGLLIILNTVGGDVEAGLAIAEMLASLSKPTVSIVLG
GGHSIGVPIAVSCDYSYIAETATMTIHPVRLTGLVIGVPQTFEYLDKMQERVVKFVTSHS
NITEEKFKELMFSKGNLTRDIGTNVVGKDAVKYGLIDHAGGVGQAINKLNELIDEARKEE
GRMIQ

BLAST