GenomeNet

>bsu:BSU16980 K06416 stage V sporulation protein S | (RefSeq) spoVS; stage V sporulation protein S (A)
MEILKVSAKSSPNSVAGALAGVLRERGAAEIQAIGAGALNQAVKAVAIARGFVAPSGVDL
ICIPAFTDIQIDGEERTAIKLIVEPR

BLAST