GenomeNet

>bsu:BSU17030 K06328 spore coat protein E | (RefSeq) cotE; spore coat protein E (A)
MSEYREIITKAVVAKGRKFTQCTNTISPEKKPSSILGGWIINHKYDAEKIGKTVEIEGYY
DINVWYSYADNTKTEVVTERVKYVDVIKLRYRDNNYLDDEHEVIAKVLQQPNCLEVTISP
NGNKIVVQAEREFLAEVVGETKVVVEVNPDWEEDDEEDWEDELDEELEDINPEFLVGDPE
E

BLAST