GenomeNet

>bsu:BSU17070 no KO assigned | (RefSeq) ymcC; hypothetical protein (A)
MNGIAWMIVFCEIAFWVVIVLGLAVRYVFKRHTLGLLFLALTPVIDLILLAATGVDLYRG
ASATAAHGIAAVYIGISIAYGKQMIQWADEKFQYYVTKKGTKPLKRFGMDHAKHGAKGWL
RHVLAYLIGAGLLAGMIYFINDSSRTEALSGILKLWTVIIGIDFLITASYFIWPKKEKAS
ANLRS

BLAST