GenomeNet

>bsu:BSU17250 no KO assigned | (RefSeq) ymaE; hypothetical protein (A)
MPYYICNTCGVQHAQTVDPPNSCLICEDERQYIHPDGQTWTTLEDMREKGNLQNILKKEE
EHLYSIKTEPEFAIGQTAHLIQHKGFNVLWDCMTYLDQKTIDQINELGGIQAIALSHPHY
YSTQVEWAEAFQAPIYIHEDDKEWVTRPSNHIHFWSGETLNMKPGLDLYRLGGHFKGGAV
LHWSKGNEGKGCLLTGDIITVAADRNWVSFMYSYPNLIPLPASKVEEIAAKVKPLQFNRL
YNAFSKVVKENADESVQRSAVRYIKALNSELFHT

BLAST