GenomeNet

>bsu:BSU17290 K11815 multidrug resistance protein EbrB | (RefSeq) ebrB; multidrug resistance protein EbrB (A)
MRGLLYLALAIVSEVFGSTMLKLSEGFTQAWPIAGVIVGFLSAFTFLSFSLKTIDLSSAY
ATWSGVGTALTAIVGFLLFGETISLKGVFGLTLVIAGVVVLNQSKAHAEDKKQTACE

BLAST