GenomeNet

>bsu:BSU17360 no KO assigned | (RefSeq) ymzA; hypothetical protein (A)
MKHKVIVNHWEEICEDDSCYEYGTSIIVNGKELIREASIITALKAVLEEIGADVEIEETV
ESEKCCDSLRKKNLDY

BLAST