GenomeNet

>bsu:BSU17420 K06413 stage V sporulation protein K | (RefSeq) spoVK; stage V sporulation protein K (A)
MLERAVTYKNNGQINIILNGQKQVLTNAEAEAEYQAALQKNEAKHGILKEIEKEMSALVG
MEEMKRNIKEIYAWIFVNQKRAEQGLKVGKQALHMMFKGNPGTGKTTVARLIGKLFFEMN
VLSKGHLIEAERADLVGEYIGHTAQKTRDLIKKSLGGILFIDEAYSLARGGEKDFGKEAI
DTLVKHMEDKQHEFILILAGYSREMDHFLSLNPGLQSRFPISIDFPDYSVTQLMEIAKRM
IDEREYQLSQEAEWKLKDYLMTVKSTTSPIKFSNGRFVRNVIEKSIRAQAMRLLMGDQYL
KSDLMTIKSQDLSIKEEASGSA

BLAST