GenomeNet

>bsu:BSU17480 no KO assigned | (RefSeq) ynzF; hypothetical protein (A)
MWKALSQLLKKQKNQSPSDEDYIQIPELEVKVLGMLHSINIDLVNVIAQAEKSKEFIGQI
EGIWHSIANQFYSLAQGFENEDINKLSADLDHAAATWEAVANKAKEFVTNSYQG

BLAST