GenomeNet

>bsu:BSU17530 no KO assigned | (RefSeq) ynaE; hypothetical protein (A)
MNLIGYIEERFQNLELIPSIYNQWGTGIHFCLGENIYQLKANEELNLKMFRIVYEQTSII
FNELFEQNDDIFLVTNMYKHKKKEKCIRKLKVYQPFLKCKNHLNQIMVKTYPYPFEINKA
EEYEMQQFSLLCKPRDLRVTELLKAASNEDFPQKPKFGGYSIDYPDVFFVNITKDIIFFI
YDDRGCEVIAHDFKRIRPLYEKYHDWVEEYKCM

BLAST