GenomeNet

>bsu:BSU17699 no KO assigned | (RefSeq) ynzK; hypothetical protein (A)
MYRNIVFYLILLCLFISVVMKSFEVIRTIANVICFIFVLLYFKDEMKTYSRKALAILSIC
FLFLVGICAFIILQGQTLMKRHLFFTGLETIAGILLIIVSLSICTFILRKISNRLKRM

BLAST