GenomeNet

>bsu:BSU17750 K06310 spore germination protein | (RefSeq) yndD; hypothetical protein (A)
MMRWRNNQYKTQKQHKSDYSTAEKQDQDVLTGNIGYDLEHVKRKIGHNGDVHFRELEITQ
LHVKAALIFVEGLSDQDLINKGLSVLVMNQPNQVSDEISQSGKGILTSKQIKNQIVSIGD
VIDSEKISDIVLNVFMGSTALLIDGIPQAFLLGTVKKQNRSIEEPLSEALVRGPRTGFTE
ELSTNTALLRQQGKNDQLTLQRFEVGTRLKKDLIIAYMNDIADPKVVEEVRKRVRGIEID
HLPESGYVEQLIEDNYLSPFPQVQSTERPDRVISGLMEGRVAILLDGTPFALIVPVTFSM
MLQSPEDYYERWFPSSLIRLLRFIAAMITLFAPALYISFISFHPGLIPTKLAISISGTRQ
GVPFPSLIEALFMEVAIEILREAGLRLPKPIGPAIGIVGGLIIGEAAVQAGIVSPIMVIV
VALTAISSFAIPHYSTGIALRMLRFGAMFCAAVFGLFGVIMYYLLLSSHVVKLKSFGVPY
ASPAVPYHLKDWKDFVIRMPLLVMKRRPKMMNTDNTKRVK

BLAST