GenomeNet

>bsu:BSU17790 no KO assigned | (RefSeq) yndH; hypothetical protein (A)
MSSIYEKSIINYHLLHPKLQKRYQLDGSHTFSGTGTMSEISGGSFLVRMLLKLGVFFRCF
FSERGKDIPFTIQNRTCLLKSQHTGIEWNRTFFFKGKKRFFDALMIYDEKENRILDFFGK
PHLLLSVLTFEASLDGSLTITSGKQWLLICGKRIPLPKWLTGTSEVCETFDEKKNCFTIE
VHVQNTILGTLFFYKGTFQEEERES

BLAST