GenomeNet

>bsu:BSU17800 no KO assigned | (RefSeq) yndJ; hypothetical protein (A)
MKRNGIVSALCFIGFLAAEAPDISVAEALVLLSILFFVPGIFPFVFRQSPVRAAQFMENG
LIQCYPVAAFFAVLALVTEVGGFALIWWMYTVFNALYAILRLWETKIHRIEETSVLFGLI
YLAGGGFWFFAYAAHLQIMQFGPLIILLTAVHFHYSAFLIPIFNGLLGRTIRKHRMLYSW
ITWVILLSPLLIALGITYSKTLDVIAVSIYMAAIYLHAFLVFTAAFRTKTGTFLIRLSSA
VLMITIAFSMIYSFGVFRQEVTLTINQMIWIHGFVNAFGVILPALIGWRIEDAKPFDADS
VKTFSRIYGKRKIGEEFLANIQAENNARYSGLVDDMGSLRSKDFSPEKLAPLILSFYEQT
IEYNIKAKVTWSTWFRPLAIIYEWFSRRIGQIHLSTNPDWYRMYSKIKGVHSKKDGRERV
RAWIRTNEKNETIFTALYSVYRSNGEGYMNISLPLPFSSMTGILKPYHHQEKLVLTSRRR
KSRAGDEGIYLQTRAGTCPLPLSETFLIEAVHDNKLTAVHHMWLFGIKFLTVHYSITHIN
QPIERT

BLAST