GenomeNet

>bsu:BSU17810 no KO assigned | (RefSeq) yndK; hypothetical protein (A)
MNCFKILHRIKTGKEGFMVFYISLFLILWLAAGFAVGMKQVYVDQLFDKAVIERLEKEAN
DHGHADRMIKQRVLYIAAVTVSGFISVYYEMKTIPQRRNIRKIEKNIMKLNQAKKRRMKR
K

BLAST