GenomeNet

>bsu:BSU17820 no KO assigned | (RefSeq) yndL; hypothetical protein (A)
MKPAKVSLLRRLLHSLKHVDCNIAKRFPSTIKIVKLLMIFMVFTPISSIYAEDVYQNFEE
LKNNEDPSDYGVVTKETGSPVLVLAIHGGGIEGGTSEVARELSKEYSMYLFEGLKSAGNS
VLHITSTHFDEPRALKMTGNHEYVISLHGYAEEDQQIEVGGTDRVRAADLVEKLQHAGFP
AVLLNMDHPHAGVSPNNIANKSKTGLSIQIEMSTGFRKSLFGIFSLKSRAVTQNERFYEF
TEVMFRFLKNSY

BLAST