GenomeNet

>bsu:BSU17940 K03413 two-component system, chemotaxis family, chemotaxis protein CheY | (RefSeq) yneI; plasmid maintenance protein CcdB (A)
MTRVLVVDDAKFMRVKIREILEEANYIIAGEAADGEQAADLYKKLRPDLVTMDITMPVKN
GIKALRDILTFDPKAKVIMCTAMRQQRIVTEAIELGAKDFIVKPFEETKVLEAVSRVMGH

BLAST