GenomeNet

>bsu:BSU17950 no KO assigned | (RefSeq) yneJ; hypothetical protein (A)
MISMMIIVSSIIAVLMAVAVMVVRIKSSDKPVSPKKIILPPIFMSTGALMFLFPVFWVTG
AEFLEAFTLGVIFSIFLIKTSKFEIKNNEIYMKRSKAFVFILVGLLVIRIVMKSILSTSI
DYGALSGMFWILAFGMIVPWRIAMYLSYRKLHNELQSSNIQMN

BLAST