GenomeNet

>bsu:BSU18080 no KO assigned | (RefSeq) yneT; hypothetical protein (A)
MQNPSKAEIKEILQRSKRIAVVGLSDRPDRTSHMVSKAMQDAGYEIIPVNPTIDEALGVK
AVSSLKEIDGPIDIVNVFRRSEQLPGVAEEFLETDAPVFWAQQGLVNEEAYQMLKEKGRT
VIMDLCIKVAHAVTK

BLAST