GenomeNet

>bsu:BSU18200 K07097 uncharacterized protein | (RefSeq) yngD; oligoribonuclease NrnB (A)
MYHLYSHNDLDGVGCGIVAKLAFGKDVEIRYNSVNGLNAQVQYFLEKAKESNRQDALFIT
DLAVNEENEERLNEYVHAGGKVKLIDHHKTALHLNEHEWGFVQVEYDDGRLTSATSLLYG
YLIENGFMKPTNALDQFTELVRQYDTWEWERYDQKQAKRLNDLFFLLSIDEFEAKMIQRL
STHDEFFFDDFEEKLLDLEDEKIERYLRRKKREMVQTFVHEHCVGIVHAESYHSELGNRL
GKDNPHLDYIAILSMGSKRVSLRTIHDYIDVSEIAGRYGGGGHAKASGCSITDEVYELFV
AEAFRIDPVRPDAFRNIYNLKGSANGSLYENRAQMRFFLFPLDNEWNIQINGETQDETFA
AFEEAEWFIKRNYAASLVRDEVFVAFLAENLKLANQHRK

BLAST