GenomeNet

>bsu:BSU18300 K15668 fengycin family lipopeptide synthetase E | (RefSeq) ppsE; plipastatin synthase subunit E (A)
MKKGADTMNTIKKIKNIYPLSHMQEGMLFHSFLRKEEGAYVEQSLFTIKGSLSYDWFQRS
IQAIIDRHDIFRTVFLPHVPHLSGPRQVVMTEREFHLNSEDISHLPTNDQNEYIERFKEK
DKQKGFDLQKDMLMRISLFKTAKDEHVCIWSHHHILMDGWCLGIVMQEFMQIYQSIHAGK
PLSLDPVRPYSTYISWLTNRDKEKAAAYWDTYLKNYSAPSPLPRVSDKETKESYHREDLI
FSLNKPLTDKLKETAKQHGVTLATLIQAVWGVMLQQYNRTDDVVFGAVVSGRPSEIPGVE
QMIGLFINTIPIRIKTHQDETFHELLIRCQKEMLEAEPFTCQPLFDIQANTALKQELIDH
IIVFENYPLQQKIADSADQTDSPLQIDQVQVSEQSGYNFNLVVAPGEELVIKFSYNAFVY
DAAWISCIKRQFTQALSTAAQHPHMPIADFSFLDATEKEQIVTQFNNTKTEYPKNHTIID
LFREQAEKTPDHTALVYGNMSISYKELDKRSNALARELIQKGFRKNETAGILAAHSPEFM
ISVLAVLKAGGAYLPLDAELPPERVSFMLEETQAKMLIVQKGLEQNAAFSGTCIISDAQG
LMEENDIPINISSSPDDLAYIMYTSGSTGRPKGVMITNRNVVSLVRNSNYTSASGDDRFI
MTGSISFDAVTFEMFGALLNGASLHIIDKSTMLTPDRFGAYLLENDITVLFLTTALFNQL
AQVRADMFRGLHTLYVGGEALSPALMNAVRHACPDLALHNIYGPTENTTFSTFFEMKRDY
AGPIPIGKPISNSTAYILDTKGRLLPIGVPGELCVGGDGVAKGYLNRVDLTNAVFSPHPF
LPGERIYRTGDLARWLPDGNLEYISRIDRQMKIRGKRIEPAEIEARLLEMEGVQEAAVTL
REKDGEAQLYTHYVGDHKKTDTDFRADLARVLPDYMIPQHWVRVERMPLTGNGKIDRSAL
PIPENKPAKRQNIILPRNLVEEELANIWKQVLGVNTISIDDDFFAIGGHSLRALQVIHTL
KHQQNIDIPIDFLFEHPTIAQLAEKLYSKQLTAANEQHVIKLNQHGAQNLFCFPPISGFG
IYFKDLALLLNEKAAVYGFHFIEQDTRIEQYVNCMTDIQPEGPYVLLGYSAGGNLAFEVA
QAMERKGLEVSDFIIVDAYLKEQPLPIDTGNDESAAYLPEAVREKVMKKKRNYQEYWAQL
LNEGHIKASIHFIEAGIHPETSGHTGLTKWEGACGNYSEYTGFGAHKDMLEGTYAEKNAD
IILDILEKITSNQVILHKR

BLAST